PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.23368s0029.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 256aa    MW: 29082.3 Da    PI: 8.8739
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.23368s0029.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.7e-322477255
               G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                          prlrWtpeLH++Fv+av+ LGG+ kAtPk +l++m+vkgLt++hvkSHLQ+YR 
  Araha.23368s0029.1.p 24 PRLRWTPELHRSFVHAVDLLGGQYKATPKLVLKIMDVKGLTISHVKSHLQMYRG 77
                          8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.4132080IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-292077IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-222476IPR006447Myb domain, plants
SuperFamilySSF466893.58E-152476IPR009057Homeodomain-like
PfamPF002497.8E-82576IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRCGRSSDG GIGGVRPYVR SPVPRLRWTP ELHRSFVHAV DLLGGQYKAT PKLVLKIMDV  60
KGLTISHVKS HLQMYRGSRL TLLGKPEESS SPSSRRRRRR QDNEEDHLHD NLSVHARNDC  120
LLGFHSFNFR QQTSATDNDD DDFLNIMNME RTKTFAGNGE SIKFQSHHFL EAENTKNNWK  180
NTWRENEHEA EDLSLSLSLN HPHNHQQRWR SNASSSLSET SEAVSSSSAP FIFRDCFASS  240
KIDLNLNLSF SLLHS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19499RRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ6304860.0AJ630486.1 Arabidopsis thaliana mRNA for hypothetical protein, clone At1g14600.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002892817.11e-154DNA binding protein
SwissprotQ700D91e-146MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLD7KBM41e-154D7KBM4_ARALL; DNA binding protein
STRINGfgenesh2_kg.1__1592__AT1G14600.11e-154(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46941852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.11e-132G2-like family protein